PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009108938.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 307aa    MW: 35281.3 Da    PI: 4.5717
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009108938.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix35.42.8e-112098280
        trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcp 80
                    Wt +  l L++    +e++ +++ +  ++W  +s+++ +  ++r+ +qC+ kw++l  +y +i ++e++++ +++s ++
  XP_009108938.1 20 WTLKDCLILVNEIAAVESDCSNALSSFQKWTMISDNCNALDVHRNFNQCRRKWDSLVSDYSQIMKWESQERGRVHSYWS 98
                    9999999*************************************************************99888877776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.0512076IPR017877Myb-like domain
PfamPF138375.6E-82097No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MEEGTSSGSR RTRSQVAPDW TLKDCLILVN EIAAVESDCS NALSSFQKWT MISDNCNALD  60
VHRNFNQCRR KWDSLVSDYS QIMKWESQER GRVHSYWSLS VEKRRKLNLP GNVDNEVFQA  120
INAVVMIQEN KDGSEPDSDS DPEAQEDFDV VDVTAELGSK RSRQRTMVVM KENPPHKRKT  180
EEERRRKNIQ EQRAKATHQK NKNMEVKKKP VVEISTDVEE EEEEEEEEEE TMSIEEEIKA  240
LEAKLGEKAD MIHAIVGRNL AKGSETEDDV GIEDKLKFVK QQGDELIACL SEIVNTLDRL  300
REVPQEI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159164KRSRQR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.76070.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009108938.10.0PREDICTED: uncharacterized protein LOC103834623
TrEMBLM4D1970.0M4D197_BRARP; Uncharacterized protein
STRINGBra010246.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121542328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.11e-112sequence-specific DNA binding transcription factors